PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023519407.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 601aa    MW: 65785.3 Da    PI: 8.612
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023519407.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1061.9e-33265322260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  XP_023519407.1 265 DDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSL-DGQITEIVYKGSHNHPK 322
                     8****************************************.***************85 PP

2WRKY105.62.7e-33439497159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d+++v++tYeg+Hnh+
  XP_023519407.1 439 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDQRAVITTYEGKHNHD 497
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    
MRLPFLEPSS SPFSFFNFLF SPFLFTISSS SSSSPLMASS SGSLDTSGNS HPSFTFSSHP  60
FMTTSYSDIL ASGIDDPPSS AAPHGSLRSS TTGVPKFKSL PPPSLPLSPP PLSPSSFFAI  120
PPGLSPAELL DSPVLLSASH PLPSPTTGSF PSQSLNWKSN YGYNQQSIKE ENKYLSNFSF  180
QTQSSKPPPS SFQPSSTTAP MNWSFQEQGK KQDGFSSENN MVKQSFSPEY GIVQNQSQIN  240
GGGQLQSDYG NNYPQQSQTV NRRSDDGYNW RKYGQKQVKG SENPRSYYKC TFPSCPTKKK  300
VERSLDGQIT EIVYKGSHNH PKPQSTRRSS LSSAGSSLSM VVSNPAANEM ADQSFTTQGS  360
AQFDGVATPE NSSISIGDDD FDRSSQKSKS VGDDYDKVEP EAKRWRREVE NNEGMSAAGS  420
RTVREPRVVV QTTSDIDILD DGYRWRKYGQ KVVKGNPNPR SYYKCTNPGC PVRKHVERAS  480
HDQRAVITTY EGKHNHDVPP ARGSGSHSLS RAFPNNDPPA TAIRPSAVAH QSNNGGHQSL  540
QTAFAVEMVQ NPNGFSFPEF GNSMGMGSGS YMNQTQPNHN LFPRAKEEPR DHDMFIQSLL  600
C
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-107WRKY family protein