PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023518945.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 247aa    MW: 27012.9 Da    PI: 6.2892
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023518945.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.23.9e-34103160259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s fprsYYrCt+++C vkk+vers +dp++v++tYeg+Hnh+
  XP_023518945.1 103 EDGYRWRKYGQKAVKNSIFPRSYYRCTTPNCGVKKRVERSFQDPSIVITTYEGQHNHP 160
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    
MSDEMFRDLF FSNPFRDGGF GDSETARNFG VSNEISGTPM NSCGSLSSSD AGAEEDGSGK  60
EKEKAMKDME DGGESSKAAG KAKKKEREPR FAFMTKTEID HLEDGYRWRK YGQKAVKNSI  120
FPRSYYRCTT PNCGVKKRVE RSFQDPSIVI TTYEGQHNHP IAATLRGNLS AAAAFPPSML  180
APMSVVGGAG FLPKPLSDPS GNSQVVGGDG YVYSQSSFGY PYNEQQSEYG VLQDIFPSPS  240
SFFNRQS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-54WRKY family protein