PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023518785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 193aa    MW: 21939.5 Da    PI: 8.4754
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023518785.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY93.91.2e-2999156259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYG+K++k++++pr+YY+C+s+gC vkk+ver++ed ++v++tYeg H he
  XP_023518785.1  99 QDGFKWRKYGKKSIKNNPNPRNYYKCSSSGCGVKKRVERDREDSSYVITTYEGIHSHE 156
                     8********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    
MNSLQNPTQF EDSSSSFMDL LDFSGYLLPD FWLEPETTAF PEAIIGGRTR SMEEATSTMD  60
KNSIDEWRER RGVKRKQKGR GGGCHKVAFR TKSELEILQD GFKWRKYGKK SIKNNPNPRN  120
YYKCSSSGCG VKKRVERDRE DSSYVITTYE GIHSHESPFS KCCNDPIFHS HGSCPNSTYL  180
HLSSPPCSST TTL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17076RRGVKRK
27077RRGVKRKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-38WRKY family protein