PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023516366.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 506aa    MW: 55686.7 Da    PI: 6.4619
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023516366.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY74.31.5e-23195251259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e++++ ++ +ei+Y+++H h+
  XP_023516366.1 195 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSECCAKK-IECCDHSGHRTEIVYRSQHSHD 251
                     7********************************98.*********************7 PP

2WRKY96.61.7e-30369425359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vkgs++pr+YYrCtsagCpv+k++e + e+p +v+itY+g H+h+
  XP_023516366.1 369 DGYRWRKYGQKMVKGSPHPRNYYRCTSAGCPVRKHIESAVENPYAVIITYKGVHDHD 425
                     9*******************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    
MAERQCYETD RLGSSKVTAG QEDDEEEMED SEDESEVELE DGGAMSELQP IESRIDSSVT  60
EATVRESPSE TLTAPSANHS SENGLPVDSA AQSLEEAELK QSPSSCHEPL AVEATPTDKV  120
QEQSQLQLSI YKGPDPEQSP TSVTQSISSS ASPSLSKHKL SPKKVQKECK PEPSQKNSSN  180
HKTASSVPNV RTPASDGYNW RKYGQKQVKS PKGSRSYYKC TYSECCAKKI ECCDHSGHRT  240
EIVYRSQHSH DPPRMISNPK ERQLVPYVEP VVKQIITEHT RRVINDSDPP TPSKEPSRET  300
NLVLVRKRQY SSDSDGNDEF KIKDENGGEP ETKQTVKKSS AGYSGTPLKP GKKPKFVVHA  360
AGDVGISGDG YRWRKYGQKM VKGSPHPRNY YRCTSAGCPV RKHIESAVEN PYAVIITYKG  420
VHDHDMPVPK KRHSPPSAPR VAVADPASMS NTQLKKTDLT ENQISSTQWS VDAEGELTGE  480
ALELGGEKAM ESARTLLSIG FEIKPC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-112WRKY family protein