PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023516298.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 624aa    MW: 68971 Da    PI: 5.314
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023516298.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.6e-32139195259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  d++++ei+Y+g H h 
  XP_023516298.1 139 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSL-DGQITEIIYKGAHIHA 195
                     7****************************************.**************97 PP

2WRKY103.31.4e-32364421259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++prsYY+CtsagC v+k+ver+++d k+v++tYeg+Hnhe
  XP_023516298.1 364 EDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCAVRKHVERASHDLKCVITTYEGKHNHE 421
                     8********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    
MPEDGSSHGS EDSCFRFAPH GELNTLQSLF RLENQEADID RQAFESEKAL MDFEFLTDFS  60
KEGSVLKYDI ASSTGNNHFD GKSVNGNCDN MESCLSAIAN NQPSTPEESA KRDDSETQHP  120
LEGEQKGSCI PMGMLRTSED GYNWRKYGQK QVKGSEYPRS YYKCTHPNCQ VKKKVERSLD  180
GQITEIIYKG AHIHAKPDPN RRAMLGSMLM PDDTPEIGEG GGNRAKVEAG LTWRNTQYGV  240
KDTKPISDWS VDGLERTSSI SVVTELSDPL LNPQGKNVGV FESVGTPELS STLASHDDDG  300
GGGGDDDDLT TQGSISVCIE ADDAEPELKR RRKEGGSIET NLASRSLREP RVVVQIETDV  360
DILEDGYRWR KYGQKVVKGN PNPRSYYKCT SAGCAVRKHV ERASHDLKCV ITTYEGKHNH  420
EVPAARNGSQ VNSSNGNSQP STSHVQPNMD LSRNSNVANS ETQIQDLAAQ FYPKPEFNYD  480
YQRSGCFDTF RNDIKLGAPS FCQMKFPQLR HTLPYSSFAL NSKHTSTSIS GSLASVVPDF  540
PISLPLNQNF SAAGFDFTNG RPIPPFQVFL SGQQLRETDR FLTPKQEHDD DNIRASFQPI  600
VDSSSASSSS LVSSVYQHMM GNFP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.16e-84WRKY family protein