PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023516216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family HRT-like
Protein Properties Length: 468aa    MW: 52427.6 Da    PI: 9.9446
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023516216.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like50.34.1e-16268297231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CGv ++ G vC+++Pv+gRKRC+eHKGm++
  XP_023516216.1 268 CGVVIGYGVVCRKPPVEGRKRCAEHKGMKV 297
                     ****************************97 PP

2HRT-like63.72.5e-20342372131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv l dGs+C+r+Pv+gRKRCeeHKG+Ri
  XP_023516216.1 342 ICGVVLYDGSPCRRTPVQGRKRCEEHKGQRI 372
                     8*****************************7 PP

3HRT-like53.44.3e-17431460231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CGv l++G  C+rqPvkgR RC eHKGmRi
  XP_023516216.1 431 CGVDLGNGLYCTRQPVKGRVRCGEHKGMRI 460
                     *****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    
MVAEFSSTRL KREDCKRTKH DSSFSKWEIL VAPSDWEDYS SGKEGAERYR IHNLPKVSGP  60
GLYELGLAVS SSGLGREIAK LDADWIVVVY LGEADNVRTR LQHYGRSGSH LGNGYLCFVD  120
CKVVPLEKGP GLFQEMFTRG YSIVYRWAPM KNKRDAQMTE AQLLKTFDYA WNTSGNGARR  180
HNDVLKKLED IASQTKKFTI IARKLLPFRQ KQMGIKIKTS KPIPTENKPG EYGEERSSFF  240
SRILHFSRSR PRLVVNTDDV SGADSNSCGV VIGYGVVCRK PPVEGRKRCA EHKGMKVNGL  300
LKNSSTIYGD TDFSGSNAET SYNTEELSVQ DSFPNKGNFL PICGVVLYDG SPCRRTPVQG  360
RKRCEEHKGQ RIRRSTLISS QEAKPKVDLP SQDNLASLKY KQQTSPTSTQ ESILIAQDNS  420
PDLNSSLERK CGVDLGNGLY CTRQPVKGRV RCGEHKGMRI KGLISRKH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-113HRT-like family protein