PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023516032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 500aa    MW: 54583 Da    PI: 8.2137
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023516032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.37.5e-34231287259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK vkgse+prsYY+Ct+ +Cpvkkk+ers  d++++ei+Y+g+Hnhe
  XP_023516032.1 231 DDGYNWRKYGQKLVKGSEYPRSYYKCTHLNCPVKKKIERSP-DGQITEIIYKGQHNHE 287
                     8****************************************.***************8 PP

2WRKY106.11.8e-33390448159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+vers++d k+v++tYeg+Hnh+
  XP_023516032.1 390 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERSSTDSKAVVTTYEGKHNHD 448
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    
MAKNDDSARP PLQRPTITLP PRPSMDAFFA AGPTGLSPGP MTLVSSFFAD GAADSPSFSQ  60
LLAGAMGSPM AMGFMGTGST PNYYAKDGGS SELEFGLKQS KPLNLMVARS PLFSVPPGLS  120
PSGLLNSPGF YGPQSPFGMS HQQALAQVTA QAALAHSHMH MQQAEYQHSL VPAPMEPLTR  180
DPSFTLDEAS QLSVLPSTSD TKSIIAESTE VSHSDRKYQP PPSNASDKPA DDGYNWRKYG  240
QKLVKGSEYP RSYYKCTHLN CPVKKKIERS PDGQITEIIY KGQHNHEPPP ANKRARDNSE  300
PTGCTNSLTK PESRSQIQAG ILNKSSENVQ SGSSDSEEQA DTEITENRDE DEPNPKRQNI  360
DVGTSGVALS HKTLTEPKII VQTRSEVDLL DDGYRWRKYG QKVVKGNPNP RSYYKCTSAG  420
CNVRKHVERS STDSKAVVTT YEGKHNHDVP AARNSSHNTV PQIKPLKVVA QKHPLLKEME  480
FGSNDQRPAV LRLKEEQITV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-136WRKY family protein