PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023515298.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 486aa    MW: 53294.3 Da    PI: 8.2276
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023515298.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.6e-33204260259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK+vkg efprsYY+Ct+++Cpv+kkvers  +++v+ei+Y+geHnh+
  XP_023515298.1 204 DDGYNWRKYGQKQVKGGEFPRSYYKCTHPNCPVRKKVERSL-EGQVTEIIYKGEHNHK 260
                     8****************************************.***************8 PP

2WRKY1061.9e-33378436159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  XP_023515298.1 378 LDDGYRWRKYGQKIVKGNPYPRSYYKCTTSGCNVRKHVERASTDPKAVITTYEGKHNHD 436
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    
MGDDEEEPPP SSPQPPSKLK LRPLRPTINL PPRTSMESLF SGGPGLGFGF SPGPMTLVSS  60
FFSDPDDCKS FSQLLAGAMT SPVAAPPLES EFKGPPGLLD SPGLLSPSQG PFGMTHQQAL  120
AQVTMQAAEA YSHKQIQAAS LSPSVAPFAS SLELSTTFLG EKTKDHPMQP PFPNAGVASK  180
EVLDISQSEQ RVQSSLCTVG RPADDGYNWR KYGQKQVKGG EFPRSYYKCT HPNCPVRKKV  240
ERSLEGQVTE IIYKGEHNHK QPQPNKRGKD VVNSNGCSST HGNPELCSQV QRKLNELKDV  300
SFIKNDQESS HVTHEQLSGT SDGEGGSEIE TGVNRKDDDE PDAKRRNTEV RLSEPASSHR  360
TLAESRIIVQ TTSEVDLLDD GYRWRKYGQK IVKGNPYPRS YYKCTTSGCN VRKHVERAST  420
DPKAVITTYE GKHNHDVPAG KISSHRSVNS NVPQLKSHNI SNKNNDHGNS RHQHAGVLRL  480
KEEQIT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.21e-130WRKY family protein