PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023512278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 249aa    MW: 27604.5 Da    PI: 6.041
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023512278.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.6e-32131188259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYY+Cts++C+vkk+vers+edp +v++tYeg+Hnh 
  XP_023512278.1 131 EDGYRWRKYGQKAVKNSPFPRSYYKCTSQNCSVKKRVERSSEDPCFVVTTYEGKHNHY 188
                     8********************************************************5 PP

Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    
MSNNEDHEKD PYYPNFEAFD PSNVGFYSDF LYDYNNFLST DIDISCSSSE AISPINDALK  60
KSLGLGESVA IGEHPSTPNS STTCSSVEAA AGGSDSAKSG EVKLDGRKKK EKREKGPRFA  120
FLTKSEIDNL EDGYRWRKYG QKAVKNSPFP RSYYKCTSQN CSVKKRVERS SEDPCFVVTT  180
YEGKHNHYCP ITLRGHNVAG VYPPSASPSL IPARILSGEF YGGVDVQQQY YEVPGYGVLE  240
DLVNPKQNP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107112RKKKEK
2107114RKKKEKRE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.19e-42WRKY family protein