PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023512174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 189aa    MW: 21130.3 Da    PI: 5.3503
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023512174.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.2e-31113171159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYG+K+vk+s++pr+YY+C+s+gC+vkkkver++ed ++v++tYeg Hnhe
  XP_023512174.1 113 MDDGYKWRKYGKKSVKNSPNPRNYYKCSSEGCNVKKKVERDREDASYVITTYEGIHNHE 171
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    
MASFPYEDPN PNPNPNFMQF SPILDPASFF DFDLSNFLVG DDDSYVDQLA SSSSEKITGM  60
DSGGSSVAVD SGSSFVVSSE PSPSIRSKNG ERKRKGEMGC RVAFRTKSEQ EIMDDGYKWR  120
KYGKKSVKNS PNPRNYYKCS SEGCNVKKKV ERDREDASYV ITTYEGIHNH ESPFVVYYNQ  180
IPSLTSTST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
192128RKRKGEMGCRVAFRTKSEQEIMDDGYKWRKYGKKSVK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.12e-43WRKY family protein