PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023512108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 220aa    MW: 25648.7 Da    PI: 9.5906
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023512108.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1016.9e-32143201159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  XP_023512108.1 143 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDHCRVKKRVERLAEDPRMVITTYEGRHVHS 201
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    
MGSKSQLLLN PQQALFEDQD HQTPPISQMG FFNFPSNPFE NPNFSTSNNN NNNSDTNLNL  60
SETLLFSSMN LPLKPSPFYE FAPPHLLSLQ TSTPNLWPWG EIGKRSNENQ LGISTMKMKK  120
IKGRRRVREP RFSFKTLSDV DVLDDGYKWR KYGQKVVKNT QHPRSYYRCT QDHCRVKKRV  180
ERLAEDPRMV ITTYEGRHVH SPSHDSEDSE AQTHLNNFFW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-59WRKY family protein