PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR81392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family HB-PHD
Protein Properties Length: 902aa    MW: 100141 Da    PI: 4.6511
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR81392.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.81.3e-11607652853
                 -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
    Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                  +e  ++L e F+ n yp++e+ e L+k++g+t  qV++WF N R 
  RWR81392.1 607 GREVSQRLCESFKANAYPTQEMLENLSKEIGITFHQVSIWFENTRR 652
                 56777999***********************************995 PP

2PHD353.2e-12234287151
                 SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSSTBSSHHHHTT CS
         PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpegewlCeeCkek 51 
                 +C+ Cg+    +++++vlCd gC++ fH+ Cl ++l + +  +++wlC+ C++k
  RWR81392.1 234 FCAKCGSkdFSANNDIVLCDgGCDRGFHQMCLVPPLLNIPPGDDSWLCPGCDCK 287
                 6999**966566********56***************8888888*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 902 aa     Download sequence    
MDVSHPVEEH CQEQNSLDTK DKHTGAEETM QVGSDFIDTD RPKPSTEDSV DFEANLRSDG  60
TPQAATNNSG TPSQIEKRVN SKLGGKRYPL RSSLEGTRVL RSRSNGVCNA PPTNTSTNSI  120
SSTTQRRKNR KKRKGQNKVS NDELADIRRR VKYLSARMNY EQSLIDAYSG EGWKRQSAEK  180
VRPEKELQRA SSEILRRKLE LRDLFQRLDT ICAEGKLQDS LFDSEGQIDS EDIFCAKCGS  240
KDFSANNDIV LCDGGCDRGF HQMCLVPPLL NIPPGDDSWL CPGCDCKSDC IGVLNDIQGT  300
NLSIEDKWEK VFPEAAAAAS GDKQQDELGL PSDDSEDDDY DPDCPEADEK IQKESSSSEE  360
SGSTSTSDGS SASADDKQHI NPGFSSDDSE DNDFDPDAPE LDEKVQSEGL SSDESDFSSD  420
TNDLIPSKYD NDSSGSDNET SPNHAEHIGG FDGGEPEVSQ RTKRTLSSEL LSTLERDQSG  480
EIFLPVSGKR LRERLDYKKL NDETYGNIHS DSSDDDDWTD MNTLKKVKRR VESKSTVMAS  540
LQNTQTIQDG ENTKQSQRKP EGEVLREQEK LPDTRTLHNL ESEGANHTMK PYYMRRKLTT  600
SRPGCFGREV SQRLCESFKA NAYPTQEMLE NLSKEIGITF HQVSIWFENT RRSFCLPETK  660
EESKEENGTP NEDSISTKAN IEEPRSGVKV VSANNKSSKT ENNTPSQDSN HTEMDVKEPG  720
SETKVVSTNK EASKTEINTP NKDNIPPKTT VNEPQPEEKV VSATKEASET ENSTPNKDSI  780
SATTNGKEPV PEVVAVADSL ASIEVEEIQP FNLSTDHATP NRKGSRKVAS TTPRWNSARY  840
ESRKRRQAML EGRAAGEALT DNAKPTRRKE TDLPGVQPDQ TNGQCNKFES VHSHVETRRY  900
SG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125134QRRKNRKKRK
2524530LKKVKRR
3842847SRKRRQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-83HB-PHD family protein