PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR78906.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family LBD
Protein Properties Length: 163aa    MW: 18165.8 Da    PI: 7.3029
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR78906.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.14e-4561051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  RWR78906.1   6 PCASCKLLRRRCAKDCIFAPYFPPDDPQKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAVAQA 104
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  RWR78906.1 105 E 105
                 7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    
MGGNSPCASC KLLRRRCAKD CIFAPYFPPD DPQKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQQDQPPLPN  120
NPMDPDEKSI LLPNNINNHP QFINYASSSN VIQEPLKRES LWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-79LBD family protein