PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR78519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family LBD
Protein Properties Length: 166aa    MW: 18719.1 Da    PI: 7.8521
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR78519.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-4061051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaC++lrr+C++dC+++pyfp+++p++fa+vhk++Gasnv+k+l+++p + r +a++s+++eA+ar++dP+yG+vg+i++lq+++   + ela +++
  RWR78519.1   6 RCAACRFLRRRCPEDCIFSPYFPSTDPQRFACVHKIYGASNVSKMLQQIPVHLRAHAADSIFFEAHARIQDPIYGCVGIISRLQHEIYANQRELANTQA 104
                 6*********************************************************************************************99987 PP

      DUF260 100 e 100
                  
  RWR78519.1 105 A 105
                 5 PP

Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    
MSNHSRCAAC RFLRRRCPED CIFSPYFPST DPQRFACVHK IYGASNVSKM LQQIPVHLRA  60
HAADSIFFEA HARIQDPIYG CVGIISRLQH EIYANQRELA NTQAAIAFNN AQQAQAQGTQ  120
IQQLQHVDEA PGFIGSCHMD QPSLDHHYHV PGFLSEKTQK SLSRSD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-37LBD family protein