PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR73665.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family LBD
Protein Properties Length: 152aa    MW: 16747.1 Da    PI: 9.9098
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR73665.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.72.2e-34171151100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++r+kC+ +C+lapyfp  ++++f+nvhklFG+ n+lk+lk++++e  +++m+++ ++A+ar  dPv+G+++++++l+ q+e++++el++++e
  RWR73665.1  17 ACAACKHQRKKCS-NCPLAPYFPPGHSQQFENVHKLFGVGNLLKTLKSTNKEMWPTVMETIQFQADARRVDPVHGCLSIVRQLKAQIEETSKELEKTNE 114
                 7***********7.7********************************************************************************9998 PP

      DUF260 100 e 100
                 e
  RWR73665.1 115 E 115
                 7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    
MSSREGKGGG ANNVNQACAA CKHQRKKCSN CPLAPYFPPG HSQQFENVHK LFGVGNLLKT  60
LKSTNKEMWP TVMETIQFQA DARRVDPVHG CLSIVRQLKA QIEETSKELE KTNEELSAES  120
MVGETPQIDI KPKNLAQPSA TSRKVRKGKS NA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-31LBD family protein