PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR73236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family LBD
Protein Properties Length: 270aa    MW: 30651.6 Da    PI: 8.8612
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR73236.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.23e-34161141100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aC+aC+++rrkC  +C+lapyfp +++++f nvh+lFG+s v+k+l++lp+++ +dam+s+ +e++ar +dPv+G+vg+i+ l+  +e ++ el+ +k+
  RWR73236.1  16 ACSACRHQRRKCY-NCPLAPYFPPNHTQQFLNVHRLFGVSSVMKILNSLPNTKWPDAMKSIQFESDARRNDPVNGCVGIINLLKAAIEATRRELDITKR 113
                 7***********6.7*******************************************************************************99987 PP

      DUF260 100 e 100
                 e
  RWR73236.1 114 E 114
                 6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    
MTSNGDCGGP YGSNQACSAC RHQRRKCYNC PLAPYFPPNH TQQFLNVHRL FGVSSVMKIL  60
NSLPNTKWPD AMKSIQFESD ARRNDPVNGC VGIINLLKAA IEATRRELDI TKRELFYCKQ  120
SEQQQQLKRQ HLQNMLASSS IAMPPLGGYQ YHSQELIELA NETHKIGCLS NRTANSQTYP  180
KPFDEMKQTT IDRYGAEELR IGYFSKRAAA NSQPFKEHKD QKPFDEMTQA TMDRYEAEES  240
STESAVGDTP PLKKLKLDGK KDKQPKPKEN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-33LBD family protein