PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR72612.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family LBD
Protein Properties Length: 306aa    MW: 34933.4 Da    PI: 9.8378
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR72612.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.64.9e-3951041100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rr+C++dC lapyfp++qp++f+nvh+lFG+ n+lk+l++l+++++++a++s+ yeA++r r P++G++g+i++lq +++q++++l+++++
  RWR72612.1   5 ACAACKYQRRECTADCRLAPYFPHDQPQHFKNVHRLFGVMNILKILAQLHPSQKRKAIRSIKYEAKIRNRYPIHGCLGIIRTLQAHIHQSQQQLDEVNA 103
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 +
  RWR72612.1 104 Q 104
                 7 PP

2DUF260119.91.4e-371432421100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkC++dC+lapyfpa+q+k+f+n+h+lFG+sn++k+lk+l+++++ dam+s+v +A++r + Pv+G++g+i  lq  ++++++el+++++
  RWR72612.1 143 ACAACKYQRRKCNTDCPLAPYFPADQRKQFENAHRLFGVSNIIKILKQLDTSQKMDAMQSIVCQANIREKYPVHGCLGIICGLQVVIHRTQQELDAVNA 241
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 +
  RWR72612.1 242 Q 242
                 7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    
MMRQACAACK YQRRECTADC RLAPYFPHDQ PQHFKNVHRL FGVMNILKIL AQLHPSQKRK  60
AIRSIKYEAK IRNRYPIHGC LGIIRTLQAH IHQSQQQLDE VNAQLSIYRE QHHQISPLPS  120
SQCSMTYGGK PQKMTVKGGS SQACAACKYQ RRKCNTDCPL APYFPADQRK QFENAHRLFG  180
VSNIIKILKQ LDTSQKMDAM QSIVCQANIR EKYPVHGCLG IICGLQVVIH RTQQELDAVN  240
AQLAICREQH HQISLSSSSS PFLPIAACAR IGEQFSYSLP KPLSKSTIQC RRCHRSFYRD  300
TPSFLE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-45LBD family protein