PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RWR72595.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Magnoliidae; Laurales; Lauraceae; Cinnamomum; Cinnamomum micranthum
Family LBD
Protein Properties Length: 263aa    MW: 30012.1 Da    PI: 6.1372
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RWR72595.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26095.65.3e-30191181101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCa+Ck++r++C  dC+ ap fp e+ ++f+nvh+lFG++nv+k+l+++++   +++++++ +eAe++ ++P +G++g+i++l  q++ +  el+++k+
  RWR72595.1  19 ACAVCKHQRKRCL-DCPWAPFFPPESYQEFENVHRLFGVNNVTKILSSIDNRLWPTVIETIQFEAEMWRSNPANGCLGMIRDLIAQIKATTRELNMVKR 116
                 7***********7.7*********************************************************************************998 PP

      DUF260 100 el 101
                 +l
  RWR72595.1 117 QL 118
                 75 PP

Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    
MNSGRDSGGR APKSGYFRAC AVCKHQRKRC LDCPWAPFFP PESYQEFENV HRLFGVNNVT  60
KILSSIDNRL WPTVIETIQF EAEMWRSNPA NGCLGMIRDL IAQIKATTRE LNMVKRQLFH  120
HRQRQQQQQE QQQEQEQEQN MAATAVMVVP PLGDFQLQAP NLALFLNKYL YSRVNATDNA  180
ESMEITFLSQ LFGDDEMNSS DQINQTIFCP IEAEASRYDY SSKSAVIETP LLDPSSDFKQ  240
QMVPKALAPV VVKCINEKGI VEK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-24LBD family protein