PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022984250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family HB-PHD
Protein Properties Length: 871aa    MW: 96700.8 Da    PI: 4.635
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022984250.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox43.65.1e-14697748556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++++  le+L + F++n+yp ++++e LA++lgL+ +qV  WF N R   +
  XP_022984250.1 697 RRLSQLALERLLASFQENQYPERATKESLAQELGLSVKQVNKWFTNTRWSTR 748
                     6789999*****************************************8766 PP

2PHD36.61e-12332387151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+     e++++lCdg C++ fH+ Cl+++l ++++p +   wlC+ C++k
  XP_022984250.1 332 FCAKCGSkeLSLENDIILCDGiCDRGFHQFCLEPPLLNTDIPLDdeGWLCPGCDCK 387
                     6999**965556********88*****************9998888*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 871 aa     Download sequence    
MEERDECTES RSNNNAEAVQ EAKTCVEAEM PTCLSNEQKH ELEATPGYTN KTGGPDEEKP  60
EVQQNMEEEN KELGSGDVLS ELSEKHNQTF SNLADNDQVE AGNLLCCDKD TENLIVPIEV  120
ETTTLLVDCS ELPPEVVNKN YIEQMNPPIE ELTQNTPFQK LETVPSNSEQ SDHKDKRILK  180
SMKINSILRS LVSSDRNMRS KTQEKDKDPE PSNDLNNFTA EEGKGKKKER NIQGKGARVD  240
EFSSIRNHLR YLLNRINYEQ NLIEAYSSEG WKGFSSDKLK PEKELQRASN EIMRRKLKIR  300
DVFQRIDALC GEGGLSKSLF DSQGQIASED IFCAKCGSKE LSLENDIILC DGICDRGFHQ  360
FCLEPPLLNT DIPLDDEGWL CPGCDCKDDC LNLLNEFQGS RLSITDGWEK VYPEAAASAA  420
GRNFDHALGL PSDDSEDDDY DPDVPDTIVQ DDKSSSETSG YASASEELES SPNVDQYLGL  480
PSDDSEDDDY DPSAPERDED VRQESSSSDF TSDSEDLAAL DSNPSSKADN LVSSSLNNTT  540
SMKNPDGRSS GGGPRKSSLY NELSSLLESG PDKDGPEPVL GRRQVERLDY KKLHDETYGN  600
VPTDSSDDTY ASISMDSSDD QGWDSNTRKR SPKTLVLALP NYRPNDDLTN VKTKHSSKRG  660
TRQKAAAVNM NKSVTKTPED TGKASSSVRR TTSSSYRRLS QLALERLLAS FQENQYPERA  720
TKESLAQELG LSVKQVNKWF TNTRWSTRHP SSVEGNKAKS SSRMGIHSSQ ASGELHQPEK  780
EFGAQHQELP TADSVVAPCQ SGDTGDVKLA TQDTKRSEFS AAKSRKRKGR SDHAASRSKD  840
SKESQRPPAK SPKVNEIQTA HSIKTRRRNS L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-92HB-PHD family protein