PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024995559.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LBD
Protein Properties Length: 216aa    MW: 24090 Da    PI: 7.1449
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024995559.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.71.3e-4581071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda+++l+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l 
  XP_024995559.1   8 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNTLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLT 102
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++k+e
  XP_024995559.1 103 SAKSE 107
                     99887 PP

Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    
MASSSNSPCA ACKFLRRKCQ PECVFAPYFP PDQPQKFANV HKVFGASNVT KLLNELHPHQ  60
REDAVNTLAY EADMRLRDPV YGCVGVISLL QHQLRQLQMD LTSAKSELSK YQNHHLCHMN  120
DASTHGVLIS PAAAATNHHH HHHDMGMINL IGGGDEVISE ERLYQQHAEF FPHTAAIRGF  180
DVKCSYDGVG QHMQYQQHRA AGSAGSDDRR TPIDPS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.33e-75LBD family protein