PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024990859.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LBD
Protein Properties Length: 162aa    MW: 18052.6 Da    PI: 8.0539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024990859.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601284.3e-40111101100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+++r+C+++C +apyf a++p+kfa vhk+FGasnv+k+l+++pe +r+da++slv+eAe r++dPvyG++g i +lq ++ ql+++la
  XP_024990859.1  11 SCAACKFMKRRCTPHCLFAPYFRADEPNKFAKVHKVFGASNVTKILNEVPEPQRQDAVNSLVFEAEERLKDPVYGCIGAIASLQDKMFQLQHDLA 105
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++k++
  XP_024990859.1 106 VAKAR 110
                     99875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    
MRSQEARSSS SCAACKFMKR RCTPHCLFAP YFRADEPNKF AKVHKVFGAS NVTKILNEVP  60
EPQRQDAVNS LVFEAEERLK DPVYGCIGAI ASLQDKMFQL QHDLAVAKAR LARCSSRASY  120
ASCSTTSPLM MLDGEFGLTS FDDFMVVDQG GLTTDFRQHP FP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.16e-60LBD family protein