PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024990504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LBD
Protein Properties Length: 225aa    MW: 24511.8 Da    PI: 6.493
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024990504.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.42.1e-42671661100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+aela
  XP_024990504.1  67 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQELPESQRVDAVSSMVYEANARLRDPVYGCAGAICQLQKQVSELQAELA 161
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_024990504.1 162 KAQAE 166
                     *9976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    
MEYSGDRSSG ATSPMAISTA VPSSFSHSHS PKTSNNSSSS QLSPTSVLTH PPPSTPSSPP  60
HPVVLSPCAA CKILRRRCVE KCVLAPYFPP TEPLKFTIAH RVFGASNIIK LLQELPESQR  120
VDAVSSMVYE ANARLRDPVY GCAGAICQLQ KQVSELQAEL AKAQAEVLNM QCQQSNLLSL  180
ICMEMDQQHV SPSPPQPPQQ QQPLYDNLNF YSDDANLGSV FELWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-61LBD family protein