PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024987895.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LBD
Protein Properties Length: 254aa    MW: 28433.9 Da    PI: 7.9522
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024987895.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26099.14.2e-3154150197
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+C ++r kC+++Cvlap fpae++++f++vhk+FG+snv+ l+k+l++e+ ++a++sl+ eA++r++dPv G +g +++++++l+  ka+ +
  XP_024987895.1  54 ACASCGHQRTKCTEKCVLAPFFPAEKTQDFQAVHKVFGVSNVTTLVKDLRREDGKKAVDSLIREANCRLKDPVLGPLGEFQRISEELRDYKAQYQ 148
                     7*****************************************************************************************99987 PP

          DUF260  96 ll 97 
                     ++
  XP_024987895.1 149 QA 150
                     65 PP

Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    
MADVGGVGRA EEITILHNYL EKYPKRYWEV RVLEAAVSPS PPPTATTSGG GVPACASCGH  60
QRTKCTEKCV LAPFFPAEKT QDFQAVHKVF GVSNVTTLVK DLRREDGKKA VDSLIREANC  120
RLKDPVLGPL GEFQRISEEL RDYKAQYQQA IHHHHHHLRQ VPITQSGVLY NNKSRQQRLI  180
GYWNGGDNNG INNGTMLDYI HSNGIGGGGG IDNSQMFNYA SLQNMEKLKQ EQDQQQGSLI  240
HPQQQIMNEF GQFY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-35LBD family protein