PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024987456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LBD
Protein Properties Length: 191aa    MW: 21381.3 Da    PI: 6.7306
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024987456.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.2e-4331129199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaC++lrr+C+++C+lap+fp ++p kf ++h++FGasnv+kll++lpe++r+da++s+vyeA+ar+rdPvyG++g i++lq+q+++l+a+la
  XP_024987456.1  31 PCAACRMLRRRCVEKCILAPHFPPDEPLKFTVAHRIFGASNVIKLLQELPESQRTDAVNSMVYEANARIRDPVYGCTGAIFQLQNQVNELQAQLA 125
                     7********************************************************************************************** PP

          DUF260  96 llke 99 
                     ++k+
  XP_024987456.1 126 KAKA 129
                     9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    
MMANDHLNGT MPPRCSSFSS RSSRTLAVLT PCAACRMLRR RCVEKCILAP HFPPDEPLKF  60
TVAHRIFGAS NVIKLLQELP ESQRTDAVNS MVYEANARIR DPVYGCTGAI FQLQNQVNEL  120
QAQLAKAKAD VLNIQCQYAA LVCIKTSRSP QTSSEESFDG LKNSFDESFQ SSNPSFYLDN  180
EQDPLWDTIW A
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-65LBD family protein