PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024977854.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LBD
Protein Properties Length: 144aa    MW: 16067.4 Da    PI: 7.7673
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024977854.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292.1e-4051041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+ rr+C++dCv+apyfpa++p+kf +vh+++Gasn+ kl+++lp + r da++sl+yeA++r+rdPvyG+vg+i+ l+qq++ ++++la
  XP_024977854.1   5 RCAVCKYFRRRCPSDCVFAPYFPANNPQKFTCVHRIYGASNIGKLIEELPVQLRADAVESLYYEAKCRIRDPVYGCVGIISLLHQQIHIAQSQLA 99 
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_024977854.1 100 KAQAE 104
                     *9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    
MTSTRCAVCK YFRRRCPSDC VFAPYFPANN PQKFTCVHRI YGASNIGKLI EELPVQLRAD  60
AVESLYYEAK CRIRDPVYGC VGIISLLHQQ IHIAQSQLAK AQAEIAFLDA NVTVAETMLA  120
SSGSLGQQNG IDHSLDHPSN PWFY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-55LBD family protein