PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024970576.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family LFY
Protein Properties Length: 436aa    MW: 47667.4 Da    PI: 7.3418
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024970576.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY633.43.6e-19314101385
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap................leaaaaaaarklr.............eleelfkayGvryltva 66 
                     mdp+++saslfkwd+raa a+p+ rl+e  ++++++                +       a+++              +lee+f+ayGvry+t++
  XP_024970576.1   1 MDPDSLSASLFKWDTRAALAQPAGRLYEPITLQQQQqpppppppppphpaamA-------ATSAGmggylvresrdlgGLEEVFHAYGVRYFTAT 88 
                     9***************9998888555444443332223345666655332221.......222113356666888898***************** PP

         FLO_LFY  67 kiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaa 161
                     kiaelGft++tL+dmkdeeld++m+sls+ifr+dllvGeryGikaavraerrr eee+  ++rr lls+d++++ldalsqeglseepvq+e+eaa
  XP_024970576.1  89 KIAELGFTANTLLDMKDEELDEMMNSLSHIFRWDLLVGERYGIKAAVRAERRRQEEED--SRRRYLLSSDTTNTLDALSQEGLSEEPVQQENEAA 181
                     ******************************************************9988..89999****************************** PP

         FLO_LFY 162 gsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkse.......ededeeeeededeegsgedgeerqrehPfivtepgevargkknGL 249
                     gsgg+g g++e++a+++     ++k+  ++++k+   + +  +       +d+ e+e+ed+ ++g+g  g erqrehPfivtepgevargkknGL
  XP_024970576.1 182 GSGGGG-GAWEMAAMRSCGGGGKTKQG-QRRSKKIGVRGRIGSssqmgggDDNFENESEDDPDNGGGGAGVERQREHPFIVTEPGEVARGKKNGL 274
                     **9998.89999988863322222222.2222222222211113345554666677778888889999999************************ PP

         FLO_LFY 250 DYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykpl 344
                     DYLf+LyeqCr+fL+qvq+iakerGekcPtkvtnqvfr+akkagasyinkPkmrhYvhCYalhcLdeeasn lrrafkergenvGawrqacykpl
  XP_024970576.1 275 DYLFHLYEQCRDFLIQVQTIAKERGEKCPTKVTNQVFRFAKKAGASYINKPKMRHYVHCYALHCLDEEASNGLRRAFKERGENVGAWRQACYKPL 369
                     *********************************************************************************************** PP

         FLO_LFY 345 vaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                     v+ia+rqgwdida+fn+hprLsiWYvPtkLrqLCh+ers+a
  XP_024970576.1 370 VSIASRQGWDIDAIFNTHPRLSIWYVPTKLRQLCHAERSSA 410
                     **************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    
MDPDSLSASL FKWDTRAALA QPAGRLYEPI TLQQQQQPPP PPPPPPPHPA AMAATSAGMG  60
GYLVRESRDL GGLEEVFHAY GVRYFTATKI AELGFTANTL LDMKDEELDE MMNSLSHIFR  120
WDLLVGERYG IKAAVRAERR RQEEEDSRRR YLLSSDTTNT LDALSQEGLS EEPVQQENEA  180
AGSGGGGGAW EMAAMRSCGG GGKTKQGQRR SKKIGVRGRI GSSSQMGGGD DNFENESEDD  240
PDNGGGGAGV ERQREHPFIV TEPGEVARGK KNGLDYLFHL YEQCRDFLIQ VQTIAKERGE  300
KCPTKVTNQV FRFAKKAGAS YINKPKMRHY VHCYALHCLD EEASNGLRRA FKERGENVGA  360
WRQACYKPLV SIASRQGWDI DAIFNTHPRL SIWYVPTKLR QLCHAERSSA AIVAAAAAST  420
SVAAGGGGGG GGHLHF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-154LFY family protein