PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024959414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family HB-PHD
Protein Properties Length: 655aa    MW: 73094.6 Da    PI: 4.3862
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024959414.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-09616653744
                     --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHH CS
        Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqV 44 
                     + +  +e L + F++n+yp++++re LAk+l+Lt +qV
  XP_024959414.1 616 LGEAATESLYQSFKENQYPDRDARENLAKELNLTHTQV 653
                     56678999*****************************9 PP

2PHD39.81e-13287342151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+   + +++++lCd +C++ fH+ Cl+++l +e++p g   wlC+ C++k
  XP_024959414.1 287 FCAKCGQteVQLDNDIILCDgECERGFHQFCLDPPLLKEQVPPGdeGWLCPACDCK 342
                     6******75556********56********************9999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    
MDVSSQKKFV QDRKNLATGQ VVFESNQEVN AECACDEKAL KNHEIMGNHK RIEVFNGSPN  60
HEPVDLTGMI SSPRKTTSEH EHGMEEIQPP KLGHPPEDGS KYSSLEQIEA NQENETKKLS  120
QSGNQKRGRP KKRERMVTGS PRVLRSRSQE KPKVPESVDA PAQDAESDGK KRRKTKKIKK  180
DQNNEFSKIK THLRYLLSRM SYEQNYIEAY AGEGWKGQSA EKIKPEKELE RARSDINRYK  240
LKIRDLFQRI DSSLEEGKIP ESLYDSEGLI DSEDEIAYTS LLFWQIFCAK CGQTEVQLDN  300
DIILCDGECE RGFHQFCLDP PLLKEQVPPG DEGWLCPACD CKVDCIDLLN DSQGADLSIG  360
DSWEKVFPET AASGNKLDDT LGLPSDDSED DDYNPDGPEV EKVEEEADGE ESSSDESDFS  420
SASEDLGAVA NNEQSLGLPS DDSEDDDDFN PDRVDSDEQA KTKSSSSDFT SDSEDLGDIN  480
KNEGTSPEVQ GSLMPEDDEE ITKASMEDDD SGPITAKRKV ARLDYKKLHD ETYGNASSDS  540
SDEEFLDTEA PRKQKNTKGA KDVDFNQQQK ISVFTPVRRT NKKLDVEGIS SSPAHVGSSA  600
PGSSDRSGTK SSYRRLGEAA TESLYQSFKE NQYPDRDARE NLAKELNLTH TQVDS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170174KKRRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.18e-79HB-PHD family protein