PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024959413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family HB-PHD
Protein Properties Length: 747aa    MW: 83224.9 Da    PI: 4.7243
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024959413.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.18.5e-15605650752
                     --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                     + +  +e L + F++n+yp++++re LAk+l+Lt +qV+ WF N R
  XP_024959413.1 605 LGEAATESLYQSFKENQYPDRDARENLAKELNLTHTQVSKWFENAR 650
                     56678999************************************99 PP

2PHD39.61.2e-13276331151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+   + +++++lCd +C++ fH+ Cl+++l +e++p g   wlC+ C++k
  XP_024959413.1 276 FCAKCGQteVQLDNDIILCDgECERGFHQFCLDPPLLKEQVPPGdeGWLCPACDCK 331
                     6******75556********56********************9999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    
MDVSSQKKFV QDRKNLATGQ VVFESNQEVN AECACDEKAL KNHEIMGNHK RIEVFNGSPN  60
HEPVDLTGMI SSPRKTTSEH EHGMEEIQPP KLGHPPEDGS KYSSLEQIEA NQENETKKLS  120
QSGNQKRGRP KKRERMVTGS PRVLRSRSQE KPKVPESVDA PAQDAESDGK KRRKTKKIKK  180
DQNNEFSKIK THLRYLLSRM SYEQNYIEAY AGEGWKGQSA EKIKPEKELE RARSDINRYK  240
LKIRDLFQRI DSSLEEGKIP ESLYDSEGLI DSEDIFCAKC GQTEVQLDND IILCDGECER  300
GFHQFCLDPP LLKEQVPPGD EGWLCPACDC KVDCIDLLND SQGADLSIGD SWEKVFPETA  360
ASGNKLDDTL GLPSDDSEDD DYNPDGPEVE KVEEEADGEE SSSDESDFSS ASEDLGAVAN  420
NEQSLGLPSD DSEDDDDFNP DRVDSDEQAK TKSSSSDFTS DSEDLGDINK NEGTSPEVQG  480
SLMPEDDEEI TKASMEDDDS GPITAKRKVA RLDYKKLHDE TYGNASSDSS DEEFLDTEAP  540
RKQKNTKGAK DVDFNQQQKI SVFTPVRRTN KKLDVEGISS SPAHVGSSAP GSSDRSGTKS  600
SYRRLGEAAT ESLYQSFKEN QYPDRDAREN LAKELNLTHT QVSKWFENAR WSFNHPGKRS  660
KIVKSQHESS TSLATENAAG HKTVEKKQSD KASAEKLVTK QMNETSSTPP KSRKRKGKTD  720
DEDSVMSPSL KDGSSNRRSG RVQAKRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170174KKRRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-82HB-PHD family protein