PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU23887.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 159aa    MW: 17950.4 Da    PI: 4.382
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU23887.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB73.14.4e-231193385
       NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l +l  lGf +y+e++ +
  PHU23887.1 11 KEDASLPKASMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKSLEVLGFGEYIEEVYA 93
                6899***************************************************************************9865 PP

Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    
MESMDIVGKT KEDASLPKAS MTKIIKEMLP PDVRVARDTQ DLLIECCVEF INLISSESNE  60
VCNREDKRTI APEHVLKSLE VLGFGEYIEE VYAAYEQHKL ETVDTVRAGK WSNNVAEMTE  120
EEALAAQQRM FAEARARMNG VVTVPPKQQE TEAEQKLDC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.46e-90NF-YB family protein