PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU22106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 147aa    MW: 16703.7 Da    PI: 5.3387
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU22106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.61.1e-5520115297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 +eqdr+lPianv+rimk++lP+nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy+eplk yl++yrelegek
  PHU22106.1  20 KEQDRLLPIANVGRIMKHILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGNLGFDDYAEPLKRYLHRYRELEGEK 115
                 89********************************************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    
MVDSNNVLRS IDSSEEGGIK EQDRLLPIAN VGRIMKHILP QNAKISKEAK ETMQECVSEF  60
ISFVTGEASD KCHKEKRKTV NGDDICWALG NLGFDDYAEP LKRYLHRYRE LEGEKANQNK  120
AATCNNSTHE EREIDELRNL QGSFYGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-64NF-YB family protein