PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU19591.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 327aa    MW: 37997 Da    PI: 5.6553
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU19591.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB347e-112512925091
       NF-YB  50 asdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                  +  + r++rk  ngd+l+wal+ +Gfedy+eplk yl + r
  PHU19591.1 251 MQVTSVRKRRKMTNGDNLIWALTIIGFEDYIEPLKGYLIRRR 292
                 333456899*****************************9877 PP

Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    
MTKSTHFLLV RTNFSSEDYA RLYLEEIVKF HEVPISIILD PIGKASKMNY SNIERSQACM  60
IDYSGSWVEH FPLIEFMYNN SYHSSIRMAP FEALYGVVFQ AMQEPAILLF LLFSDLDSGT  120
AFSQIEVDMD FDAIWVCKKG RFCDSIDVFE AMPEKNIESH NAILSLYLGI DDFMSVRKEF  180
DKIDERNIIC WNAMINGYMK DDEEQFDDVA RCRSKLLTCV EKLTRATIKK LTHGMVEHNK  240
AFSAASIISK MQVTSVRKRR KMTNGDNLIW ALTIIGFEDY IEPLKGYLIR RRYALLLRIN  300
DMELLIVFTF DMSLSMPQGL FLMSERH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-09NF-YB family protein