PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU16820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 238aa    MW: 26605.6 Da    PI: 6.2203
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU16820.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB167.71.4e-5264158195
       NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                 vreqdrf+Pianv+rim+k+lP +akis+d+ket+qecvsefisfvt+ea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+++l++yre+++
  PHU16820.1  64 VREQDRFMPIANVIRIMRKILPPHAKISDDSKETIQECVSEFISFVTGEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLHLHRYRECDS 158
                 69******************************************************************************************875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    
MDLGGGKGGG GFHGYHRFPP TTSDGKVTEM NMNLSAQLNH AIPPTNHNNN NNHASVTDDS  60
ECTVREQDRF MPIANVIRIM RKILPPHAKI SDDSKETIQE CVSEFISFVT GEANDRCQRE  120
QRKTITAEDV LWAMSKLGFD DYIEPLTLHL HRYRECDSGD RGSLRGEPLM LMKPRGVVVD  180
PAASTSINAN MIPINYPLPP NFTMAHHHHG YFTYAHMSHD NVASNSQANH DEANNVEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411GGGKGGGG
2512GGGKGGGG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-66NF-YB family protein