PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU13346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 177aa    MW: 20294 Da    PI: 6.6675
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU13346.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.25e-5332127297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 +eqdr+lPianv+rimkk+lP nakisk+aket+qecvsefisfvt+ea dkc++ekrkt+ngdd++wal++lGf+dyveplk yl+k+rele+e+
  PHU13346.1  32 KEQDRLLPIANVGRIMKKILPPNAKISKEAKETMQECVSEFISFVTGEACDKCHNEKRKTLNGDDICWALGSLGFDDYVEPLKRYLHKHRELESER 127
                 89*******************************************************************************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    
MVDNNNINIL RSKYHKESSN YTSISEDNGV IKEQDRLLPI ANVGRIMKKI LPPNAKISKE  60
AKETMQECVS EFISFVTGEA CDKCHNEKRK TLNGDDICWA LGSLGFDDYV EPLKRYLHKH  120
RELESERMDQ NKCVIGVLGN NNIDQDQKER DESSTMPFKI TIMDHKGGNN FLPKTPY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-57NF-YB family protein