PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 186aa    MW: 20507.8 Da    PI: 5.121
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12936.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.91.1e-5624119297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 reqdrflPianvsrimkk+lPanakiskdake+vqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplk+yl+++r+leg+k
  PHU12936.1  24 REQDRFLPIANVSRIMKKALPANAKISKDAKEVVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYIEPLKIYLQRFRDLEGQK 119
                 89*******************************************************************************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    
MADSDNESGG HRENNSNSIE SSLREQDRFL PIANVSRIMK KALPANAKIS KDAKEVVQEC  60
VSEFISFITG EASDKCQREK RKTINGDDLL WAMTTLGFEE YIEPLKIYLQ RFRDLEGQKS  120
GLTGEKDNGG SVNMSSSYVE EYGMMMMGGQ HHQGHAYGTG VYSQAAENGA GVGTAESRFP  180
DVGRPR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-72NF-YB family protein