PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 129aa    MW: 14893.8 Da    PI: 6.2943
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB46.68.5e-152554093
       NF-YB 40 sefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                s fi  +t +a++  + +krk ++++d++wa+ ++G+++y e l+ yl+kyr+ 
  PHU12932.1  2 SYFIHRITIKANEYYHMDKRKIVTAEDIIWAMNNVGLHNYGELLTHYLHKYRQE 55
                67999***********************************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    
MSYFIHRITI KANEYYHMDK RKIVTAEDII WAMNNVGLHN YGELLTHYLH KYRQENSMHY  60
LWSNIMQPNA PSSLILPINS VPMMSHGYPH FSPNVLLNDL VAAVMTNVRK ENIVAENDED  120
PDSSESSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-13NF-YB family protein