PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12931.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 151aa    MW: 17282.7 Da    PI: 6.5981
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12931.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB63.73.7e-201771793
       NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                m+k+lP +a + +da e +q+ +s fi  +t + ++ c+ +krk ++++d++wa+ ++G+ +y + l+ yl+k+r+ 
  PHU12931.1  1 MHKTLPMHATVNDDAVEAIQKIMSYFIHCITIKDNEYCHMDKRKIVTTEDIIWAMKNVGLYNYGKLLTHYLHKHRQE 77
                89************************************************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    
MHKTLPMHAT VNDDAVEAIQ KIMSYFIHCI TIKDNEYCHM DKRKIVTTED IIWAMKNVGL  60
YNYGKLLTHY LHKHRQENSM HYLRPNIMQP NAPSSLILSI NSVSMMSYGY PHFSPNVLLN  120
DPVAAVMTNV RKENIVAEND EDPDSSESSS S
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-20NF-YB family protein