PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 145aa    MW: 16621.8 Da    PI: 4.8737
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12930.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB63.73.8e-202702492
       NF-YB 24 nakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                ++ i +da e +q+ +s fi  +t +a++ c+ +krk ++++d+lwa+ ++G+++y+e l+ yl+ky +
  PHU12930.1  2 HSTINDDAVEAIQKIMSYFIQRITIKANEYCHMNKRKIVTAEDILWAMNNVGLNNYMEFLTDYLHKYHK 70
                57899**************************************************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    
MHSTINDDAV EAIQKIMSYF IQRITIKANE YCHMNKRKIV TAEDILWAMN NVGLNNYMEF  60
LTDYLHKYHK ENSMHYLRPT IVPPSTPSSL IFSINSVPMM TYVYAQFSQN VLLNDSVAAV  120
MTNVRNENMV AENDEDPDSS ESSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-21NF-YB family protein