PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 158aa    MW: 18244.8 Da    PI: 6.5063
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12929.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB73.43.5e-231771793
       NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                m+k+lP +a i +da + +q+ +s fi  +t +a++ c+ +krk + ++d++wa+ ++G+++y e l+ yl+kyr+ 
  PHU12929.1  1 MHKILPMHATINDDAVDAIQKIMSYFIHHITIKANEYCHMDKRKIVIAEDIIWAMNNVGLHNYGELLTHYLHKYRQE 77
                89*************************************************************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    
MHKILPMHAT INDDAVDAIQ KIMSYFIHHI TIKANEYCHM DKRKIVIAED IIWAMNNVGL  60
HNYGELLTHY LHKYRQENSM HYLRSNIMQS NAPSSLILPI NSVPMMSYGY LHFSPNVLLN  120
DPVAVVMTNV RQKRQMDRNE NMVAENDEDP DSSESSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-24NF-YB family protein