PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 129aa    MW: 14881.7 Da    PI: 5.556
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB54.92.1e-172544092
       NF-YB 40 sefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                s fi  +t +a++ c+ +krkt++++d+lwa+ ++G+++y+e l+ yl+ky  
  PHU12928.1  2 SYFIQRITIKANEYCHMNKRKTVTAEDILWAMNNVGLNNYMEFLTDYLHKYHR 54
                679************************************************64 PP

Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    
MSYFIQRITI KANEYCHMNK RKTVTAEDIL WAMNNVGLNN YMEFLTDYLH KYHRENSMHY  60
LRPTIVSRST PSSLILPNNS VPMMSYVYAQ FSPNVLLNDS IASVMTNVRN ENMVAENDED  120
PDSSESSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.28e-16NF-YB family protein