PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU12927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 239aa    MW: 27418.4 Da    PI: 6.2216
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU12927.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB67.13.4e-211761792
       NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                m+k+lP ++ i +d  e +q+ vs fi  +t +a++ c+ +krk ++++d++wa+ ++G+++y e l+ yl+ky +
  PHU12927.1  1 MHKTLPMHTTINDDVVEEIQKIVSYFIHRITIKANEYCHMDKRKIVTAEDIIWAMNNVGLHNYGELLTHYLHKYHQ 76
                89************************************************************************86 PP

2NF-YB383.9e-121291645792
       NF-YB  57 ekrktingddllwalatlGfedyveplkvylkkyre 92 
                 + rkt++++d+lwa+ ++G+++yve l+ yl+kyr 
  PHU12927.1 129 NVRKTLTAEDILWAMNNVGLNNYVEFLTDYLHKYRR 164
                 67********************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    
MHKTLPMHTT INDDVVEEIQ KIVSYFIHRI TIKANEYCHM DKRKIVTAED IIWAMNNVGL  60
HNYGELLTHY LHKYHQENSM HYLRPNIMQP NAPSSLILPI NSVPMMSYGY PHFPPNVLLN  120
DPVAAVMTNV RKTLTAEDIL WAMNNVGLNN YVEFLTDYLH KYRRENSMHY LRPAIVPPST  180
PSSLILPINS VPMMSYVYAQ FLPNVLLNDS VAAVMTNVRN ENMVTENDED PDSSESSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-21NF-YB family protein