PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU07818.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 193aa    MW: 20134.9 Da    PI: 6.679
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU07818.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.22.4e-5821116297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+kyre+egek
  PHU07818.1  21 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLAKYREMEGEK 116
                 89********************************************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    
MADSDNESGG QNAGNSEGST REQDRFLPIA NVSRIMKKAL PANAKISKDA KETVQECVSE  60
FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFEEYVE PLKIYLAKYR EMEGEKTTMG  120
RSGEKDGSGG GXGGYNGGGG GTGGMYGGMG GSMMYHTQGG HQMYGSSHGS YHHMGMGGGG  180
GGGGGGGSGQ GRR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-75NF-YB family protein