PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU06664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 178aa    MW: 19227.3 Da    PI: 7.5739
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU06664.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.91.1e-5632125194
       NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                 vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl++yre +
  PHU06664.1  32 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREGD 125
                 69*****************************************************************************************965 PP

Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    
MADGHGSSRS PASPNGGGSH ESGGDQSPRS NVREQDRFLP IANISRIMKK ALPANGKIAK  60
DAKETVQECV SEFISFITSE ASDKCQREKR KTINGDDLLW AMATLGFEDY IEPLKVYLAR  120
YREGDSKGTA KAADGSSKRD GMQPGPNSQL AHQGSFSQGM NYGNSQGQHM MVPMQGTD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.14e-91NF-YB family protein