PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU03055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 217aa    MW: 24476.4 Da    PI: 7.0596
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU03055.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.82.1e-5552147297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++ lGfedyv plk+ylkkyrelegek
  PHU03055.1  52 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITILGFEDYVTPLKQYLKKYRELEGEK 147
                 89*******************************************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    
MEDERQRNGR NVAAIESPES SSNTTIPISS HITTSTLTII SNNVNNNNSS NKEQDRFLPI  60
ANVGRIMKKV IPGNGKISKD AKETVQECVS EFISFVTGEA SDKCQREKRK TINGDDIIWA  120
ITILGFEDYV TPLKQYLKKY RELEGEKLNV PKQQRLEPHQ QHEQKPTFSY SNAYSPTGLV  180
PQALFIPADQ SFPLSFSPNS IQSQLPKQEH VDSMGHW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.12e-69NF-YB family protein