PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU00710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 161aa    MW: 17920.5 Da    PI: 6.267
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU00710.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1711.3e-5326118294
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                 req+r+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tseasdkcq+ekrktingddll alatlGfedy+eplkvyl++yre+ 
  PHU00710.1  26 REQERYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLSALATLGFEDYIEPLKVYLTRYREVT 118
                 89*****************************************************************************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    
MAEPASSGGG GSHESGGDPS PQSNLREQER YLPIANIGRI MKKALPANGK IAKDSKDTVQ  60
ECVSEFISFI TSEASDKCQK EKRKTINGDD LLSALATLGF EDYIEPLKVY LTRYREVTAV  120
SISLMFLGLV SHRTALFSQF HVLLGFLIIW FARELIREYM D
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.24e-59NF-YB family protein