PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU00549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 187aa    MW: 21014.4 Da    PI: 8.1739
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU00549.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.89e-5525120297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 +e d+flPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk yl+kyre egek
  PHU00549.1  25 KELDKFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVVPLKSYLNKYRESEGEK 120
                 788******************************************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    
MTGKRSQNSP VGSPLSGNTS DNSSKELDKF LPIANVSRIM KKSLPANAKI SKEAKETVQE  60
CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMTTLGFE NYVVPLKSYL NKYRESEGEK  120
SIMARNDQET SREPITSTGT SYNNVTKFSL ARPEFIQRFN ENFSSQNYGD NYGENLTSKA  180
NLHGVEW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-63NF-YB family protein