PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHU00457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 203aa    MW: 22974.4 Da    PI: 7.0172
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHU00457.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB71.51.4e-221521964892
       NF-YB  48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                 s asdkcq+ekrktingddl+wal+tlGfedy+eplkv+l++yre
  PHU00457.1 152 SLASDKCQKEKRKTINGDDLIWALTTLGFEDYIEPLKVHLTRYRE 196
                 569*****************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    
MLSGYAKNET FCDAVDVFEA MPVKNVASHN AMLSLYLGIG DFMSVRIRRL ESVWDDEEQF  60
DDVARCRSKL SKSCDLFRVL LDFAITSMFL VRHGGDLDCT RKKMSLQVER KLMLEYDTKK  120
GKNSLLKAGY VGWLLYTAAS TGDLASGIHS SSLASDKCQK EKRKTINGDD LIWALTTLGF  180
EDYIEPLKVH LTRYREEIAV SPH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.33e-23NF-YB family protein