PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT99514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 193aa    MW: 21845.4 Da    PI: 4.5051
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT99514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.53.9e-5322115295
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                 reqdrf+Pianv+rim+++lPa+akis+d+ket+qecvsefisf+tsea+++cqre+rkti+++d+lwa+++lGf+d++epl++yl++yre++g
  PHT99514.1  22 REQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEFISFITSEANERCQREQRKTITAEDVLWAMSKLGFDDFIEPLTLYLHRYREFDG 115
                 89*****************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    
MEMSMGVPAQ ANNAEDSECS IREQDRFMPI ANVIRIMRRI LPAHAKISDD SKETIQECVS  60
EFISFITSEA NERCQREQRK TITAEDVLWA MSKLGFDDFI EPLTLYLHRY REFDGGDRGS  120
FRGEPPLMLR RGVFDPPNHL LPPNFPMAHH QYGYFVYPPP PMGNGYMQGG GSTSHAALES  180
DDAESPTEDE GNE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-68NF-YB family protein