PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT97393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YB
Protein Properties Length: 147aa    MW: 16650.6 Da    PI: 4.5182
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT97393.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB149.18.7e-47498397
       NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                e+ +++Pianv+rimk++lP  akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf++y+e +  yl k r++e++k
  PHT97393.1  4 EHVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFERQK 98
                566899**************************************************************************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    
MVDEHVKLVP IANVGRIMKQ ILPPTAKISK EAKETMQECA SEFISFVTGE ASDKCHKENR  60
RTVNGDDICW ALSSLGFDNY AEVMLRYLYK LRDFERQKAN QNKGSNDEED TDDEEVPSEC  120
EKQESATTSS APLEFNVMER GCKLSFS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-54NF-YB family protein