PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO96273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 760aa    MW: 82207.5 Da    PI: 7.6989
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO96273genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-094374741954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OMO96273 437 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 474
               554459******************************88 PP

2BELL123.86.7e-40301372172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +rqelq+kkakL+s+l+eV++rY+qy++q+q+v+ssFe++ag g+ak+Yt+lAl++iS++FrcLkdaia+qi
  OMO96273 301 QRQELQMKKAKLVSMLDEVEQRYRQYHHQMQIVVSSFEQAAGFGAAKSYTALALQTISKQFRCLKDAIAGQI 372
               69*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    
MATYFHGSSE FQAASAAAAA AATPDGTMHT LFLMNPNYVP VPYSDTPPTS SATNMFFLNP  60
AGNALNPSSL PHAPPPSHHH HHQLLGLPLP TPTASTDDPS RPSPLQGIVS GIHYNLWAGS  120
NNIDHQNNST GGSSHHQVVS AAAAGSSGGA QDMASQLGLR RGGPVVSPRQ GLSLSLSSQQ  180
QQVYRSSNNV ETDHNIQGQI SVADEMRISA GNSASSVSVV SNGMNNPGGV QSVVLGSKYL  240
RAAQELLDEV VNVGKGIKSS DVSEGTKERI KMNKDSVAGG EGSSGGVENG AKRGPELTTA  300
QRQELQMKKA KLVSMLDEVE QRYRQYHHQM QIVVSSFEQA AGFGAAKSYT ALALQTISKQ  360
FRCLKDAIAG QIKATSKSLG EEDCLGAKVE GSRLRFVDHQ LRQQRALQQL GMIQHNAWRP  420
QRGLPERAVS VLRAWLFEHF LHPYPKDSDK HMLAKQTGLT RSQVSNWFIN ARVRLWKPMV  480
EEMYLEEVKE QERNGSEEKS EPKDHSGSAS SSAQESASLN KMDHQVKSQS SRPNKSINQI  540
NITSPTDQFS NSTISTSPNM RGTSLLMPPT AFNLIGSSDL IDVNAAQRSP KKPRGNILQD  600
MHNNSHSSIL SMDMDMKQGE TRPEINIKFG DERMSSKDSY SLLTGTANHG DGGGGFGGYS  660
TMGEIGRFDP EQLTPRFHGN SVSLTLGLPH CDNLSLSGNQ QNFLSNQNIQ LGKRLELGPS  720
ESDFCGINTQ QASHSSTGYD SIELHNRKRF AAPLLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-117TALE family protein