PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO96180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 583aa    MW: 65391.6 Da    PI: 7.1775
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO96180genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.8e-202880456
              -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               ++++++q+++Le++F+++++p+ ++r++L+k lgL+ rq+k+WFqN+R++ k
  OMO96180 28 YHRHNTQQIQTLEAYFKECPHPDDNQRRQLSKDLGLEPRQIKFWFQNKRTQIK 80
              67899********************************************9987 PP

2START105.21.1e-332123883165
               HHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
     START   3 aeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
               a  a++elv++ +++ep+W k++  +ng++v+q++  +++            + e +++s+vv m++ +lv+ +ld   +W   ++    ka+t++v+++g
  OMO96180 212 AGNAMDELVRLLQVNEPLWIKLP--SNGTYVIQRENYERTfskaihlrspsARFESSKDSAVVSMNAIQLVNMFLDAD-KWADLFPtivtKAKTIQVLETG 309
               6789*******************..999999999988888899999**9*99**************************.99988888888*********** PP

               ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
     START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                     g lqlm+a++  lsp v+ R+f+f+R+++q + g wvivdvS ++ ++ ++      + +lpSg++i++++ng sk +
  OMO96180 310 ligsrhGSLQLMYAQMHILSPFVAhREFYFLRHCQQIKTGLWVIVDVSYTVIEESTS-----QCWKLPSGCMIQEMPNGCSKSI 388
               ***************************************************999875.....7888*************99865 PP

Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    
FIAMGSNGNS SNEQDAYDSH SRNAKKIYHR HNTQQIQTLE AYFKECPHPD DNQRRQLSKD  60
LGLEPRQIKF WFQNKRTQIK TQNERADNSV LRAENERIHC ENLAIREALK NVICPSCGGP  120
PFGEEERQLS LQKLKLENEQ LKEKHKNVSK LLYKYTGKEF AEIESLSSSI STPMLPISVT  180
TQETRCLALH HNLDPKTYNN IHMERAILFE AAGNAMDELV RLLQVNEPLW IKLPSNGTYV  240
IQRENYERTF SKAIHLRSPS ARFESSKDSA VVSMNAIQLV NMFLDADKWA DLFPTIVTKA  300
KTIQVLETGL IGSRHGSLQL MYAQMHILSP FVAHREFYFL RHCQQIKTGL WVIVDVSYTV  360
IEESTSQCWK LPSGCMIQEM PNGCSKSIEI GQPKGVIVSA ATSLWLPNPC QNVFSLLTDE  420
KTRVQWDVLC DGNLVNEIAN ISIGDIPRNR VTILRPFVPS ESNMLMLQEM SGNELLGYML  480
VYAPISTPAI NIALNGEDSS NVPILPSGFI VSNDGHRPER GVGAAESTKS SGSLLTVVFQ  540
ILVSSNPSSS KELNIQSVAT VNTLISSTVQ RVKALLSCCN NLD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-104HD-ZIP family protein